DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2.7

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_571494.1 Gene:nkx2.7 / 30694 ZFINID:ZDB-GENE-990415-179 Length:269 Species:Danio rerio


Alignment Length:141 Identity:67/141 - (47%)
Similarity:82/141 - (58%) Gaps:27/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 EEDIDD---------VDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAP 573
            ||::|.         .|.:..|..|:..........:||.||||::.|.:||||||:||||||||
Zfish    88 EEEMDANEETSMCPFTDSSYSSKNGETLREKPKQRLRRKPRVLFSQTQVFELERRFKQQRYLSAP 152

  Fly   574 EREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVP 638
            ||:|||..::||.|||||||||.|||.||.:.:|..|                  |..|||||||
Zfish   153 ERDHLALALKLTSTQVKIWFQNRRYKCKRQRQDKSLE------------------LAGPRRVAVP 199

  Fly   639 VLVRNGKPCLG 649
            ||||:||||.|
Zfish   200 VLVRDGKPCHG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 38/52 (73%)
nkx2.7NP_571494.1 COG5576 87..210 CDD:227863 66/139 (47%)
Homeobox 127..180 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.