DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Gbx1

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_056554.1 Gene:Gbx1 / 231044 MGIID:95667 Length:418 Species:Mus musculus


Alignment Length:33 Identity:10/33 - (30%)
Similarity:14/33 - (42%) Gaps:5/33 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 CII----FSINTALENEIEI-IDRKPSECNSKG 198
            |::    ||....||..|.: ...||..|:..|
Mouse   341 CLLCGKKFSHGAHLEVHITVHTGEKPYSCSKCG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649
Gbx1NP_056554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..320
Homeodomain 317..373 CDD:459649 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.