DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-1

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_011242403.1 Gene:Nkx2-1 / 21869 MGIID:108067 Length:423 Species:Mus musculus


Alignment Length:546 Identity:156/546 - (28%)
Similarity:195/546 - (35%) Gaps:195/546 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 AKVPSSQRSGFHISDILNLEGSELKNAAAAAAAAAHHGSDLSHHSASESTSGHRGQGSHTSP--- 251
            ||..:.|....|.|.:.....:.|:.....:|.:......:|              ..||:|   
Mouse    14 AKTNARQPPSLHSSQLRRTRSTPLRVHPTRSALSRRRIMSMS--------------PKHTTPFSV 64

  Fly   252 -SALSPTPAGVSADEHHNGSG-TGGGAGEADHHSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQ 314
             ..|||      .:|.:...| .|||.|...........|||:...|||                
Mouse    65 SDILSP------LEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQH---------------- 107

  Fly   315 HHQQAVAPLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEM 379
                     .:.||  |...:..|..||....| ||:       |.|.|.       .|:.|: |
Mouse   108 ---------AVGHH--GAVTAAYHMTAAGVPQL-SHS-------AVGGYC-------NGNLGN-M 145

  Fly   380 SSYHHMAQTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKS 444
            |.......||...:....|      ||    |:||...|..|.    ::|               
Mouse   146 SELPPYQDTMRNSASGPGW------YG----ANPDPRFPAISR----FMG--------------- 181

  Fly   445 YSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHD 509
                                                                .|.|:|.:|.|  
Mouse   182 ----------------------------------------------------PASGMNMSGMG-- 192

  Fly   510 DSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPN-KKRKRRVLFTKAQTYELERRFRQQRYLSAP 573
                  |:           ||.|..:.....||: .:|||||||::||.|||||||:||:|||||
Mouse   193 ------GL-----------GSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAP 240

  Fly   574 EREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE-------GHPGLLHGHATHPHHPSA-LP 630
            |||||||:|.||||||||||||||||.||...:|..:       |..|...|.|..|....| ..
Mouse   241 EREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQ 305

  Fly   631 SPRRVAVPVLVRNGKPCLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAA--- 692
            |||||||||||::||||     :.||.....:|..:.|.|.|...       |.|.|.||||   
Mouse   306 SPRRVAVPVLVKDGKPC-----QAGAPAPGAASLQSHAQQQAQQQ-------AQAAQAAAAAISV 358

  Fly   693 ---AAGLHAHAHAHAHAHGHGHPHAH 715
               .|||.||......:.|.....||
Mouse   359 GSGGAGLGAHPGHQPGSAGQSPDLAH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
Nkx2-1XP_011242403.1 Homeobox 215..269 CDD:395001 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.