DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and R03G8.1

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_510172.2 Gene:R03G8.1 / 187544 WormBaseID:WBGene00010996 Length:663 Species:Caenorhabditis elegans


Alignment Length:197 Identity:37/197 - (18%)
Similarity:64/197 - (32%) Gaps:57/197 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 PLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMA 386
            |..|||.:.|...:..|.|.:...  ..||                            :...::|
 Worm   307 PFQLAHEKYGTPVTREHLNGSLCR--EDHN----------------------------TLLDYLA 341

  Fly   387 QTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADS 451
            |.:..:||.:..|   :|...:.|.|||       :..:.::.:. :...|....:.:....:|:
 Worm   342 QFLDAYSGSNDSI---QLKREKSPNSPD-------QRKFAFLWTT-RLGHATENGFDATENGSDN 395

  Fly   452 DALS--------VGDALHTLHGSSGNGSAGGAPTAHALHNNNN--------NTTNNNNHSLKAEG 500
            |.|:        :.|:...|.|..|....|...||....:.||        |:...|...||...
 Worm   396 DFLNFFIKHRKKLEDSFVLLLGDHGFRLGGVRNTAVGAIDVNNPLTAISVPNSLRTNTDILKILN 460

  Fly   501 IN 502
            :|
 Worm   461 MN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475
R03G8.1NP_510172.2 DUF229 74..651 CDD:281053 37/197 (19%)
ALP_like 175..483 CDD:293745 37/197 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.