Sequence 1: | NP_476786.2 | Gene: | vnd / 31003 | FlyBaseID: | FBgn0261930 | Length: | 723 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510172.2 | Gene: | R03G8.1 / 187544 | WormBaseID: | WBGene00010996 | Length: | 663 | Species: | Caenorhabditis elegans |
Alignment Length: | 197 | Identity: | 37/197 - (18%) |
---|---|---|---|
Similarity: | 64/197 - (32%) | Gaps: | 57/197 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 322 PLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMA 386
Fly 387 QTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADS 451
Fly 452 DALS--------VGDALHTLHGSSGNGSAGGAPTAHALHNNNN--------NTTNNNNHSLKAEG 500
Fly 501 IN 502 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vnd | NP_476786.2 | Homeobox | 548..601 | CDD:278475 | |
R03G8.1 | NP_510172.2 | DUF229 | 74..651 | CDD:281053 | 37/197 (19%) |
ALP_like | 175..483 | CDD:293745 | 37/197 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |