DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and ceh-27

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:214 Identity:63/214 - (29%)
Similarity:85/214 - (39%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 ASPDSTSPVTSEVSYTYIGSNCQTSPALS---------GDYKSYSRSADSDALSVGDALHTLHGS 466
            ::|:|.:|.|...|...|.:...|:..:|         .|:.||:.||                 
 Worm    11 SAPNSVTPTTDAFSTLSISAPATTAAQMSYFAFPNQYPHDFSSYNTSA----------------- 58

  Fly   467 SGNGSAGGAPTAHALH----NNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDA 527
                :...||...|.|    |.|...||..|..|..:                            
 Worm    59 ----AYATAPYPMATHPQLANFNRFQTNQLNLGLTTQ---------------------------- 91

  Fly   528 DGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIW 592
                       ..:...:|||||||:..|.:.|||:|:..|||||.:||:||..|.|:.||||||
 Worm    92 -----------QNMMISRRKRRVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVKIW 145

  Fly   593 FQNHRYKTKRAQNEKGYEG 611
            |||.|||.||.:.||..:|
 Worm   146 FQNQRYKCKRQEKEKKMDG 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 33/52 (63%)
ceh-27NP_001256348.1 homeodomain 99..157 CDD:238039 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.