DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and R03G8.3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 / 181437 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans


Alignment Length:69 Identity:17/69 - (24%)
Similarity:26/69 - (37%) Gaps:18/69 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TSSSSGLAPEQLRIPTGAAAFSGFPGLHSMSSLMLPSSAAVAAAAAAPFLPWSPILLPP---WNH 168
            |..|..|:|:|            :.||:...|..:||...:..:...   ||....||.   |:.
 Worm    32 TMFSPLLSPQQ------------YLGLYQPISGNIPSKVVMNKSEVE---PWDQCELPQYDIWDD 81

  Fly   169 ALLP 172
            .:||
 Worm    82 EILP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053
ALP_like 190..480 CDD:293745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.