DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-6

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:206 Identity:77/206 - (37%)
Similarity:99/206 - (48%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 DDADGSGGGDANGSDGLPNK---KRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTP 586
            |...|:..||......:..:   :||.||||::||...|||||:|||||:|||||||||.::||.
Mouse   100 DRGVGNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTS 164

  Fly   587 TQVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLG 649
            |||||||||.|||:|..:.::..|  |||                .:||||||||||.:|||||.
Mouse   165 TQVKIWFQNRRYKSKSQRQDQTLELAGHP----------------LAPRRVAVPVLVLDGKPCLD 213

  Fly   650 ---------------------------DSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQ 687
                                       |:| ..:.|.|.|:........|::........||...
Mouse   214 PDVAAFLGPYKATSPYSCFGGYAGTPYDAS-YASRCTSASAGPGPLTPLASSGFSPGGQSAAPQG 277

  Fly   688 HAAAAAAGLHA 698
            |..|...|:.|
Mouse   278 HLPATPQGVTA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 39/52 (75%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 4/24 (17%)
Homeobox 126..179 CDD:278475 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833343
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.