Sequence 1: | NP_476786.2 | Gene: | vnd / 31003 | FlyBaseID: | FBgn0261930 | Length: | 723 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035050.2 | Gene: | Nkx2-6 / 18092 | MGIID: | 97351 | Length: | 289 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 77/206 - (37%) |
---|---|---|---|
Similarity: | 99/206 - (48%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 525 DDADGSGGGDANGSDGLPNK---KRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTP 586
Fly 587 TQVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLG 649
Fly 650 ---------------------------DSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQ 687
Fly 688 HAAAAAAGLHA 698 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vnd | NP_476786.2 | Homeobox | 548..601 | CDD:278475 | 39/52 (75%) |
Nkx2-6 | NP_035050.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..125 | 4/24 (17%) | |
Homeobox | 126..179 | CDD:278475 | 39/52 (75%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 259..289 | 7/30 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833343 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |