DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-2

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:280 Identity:115/280 - (41%)
Similarity:136/280 - (48%) Gaps:75/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 GSSGNGSAGGA---PTAHALHNNNNN-------TTNNNNHSLKAEGINGAGSGHDDSLN--EDGI 517
            |..|.|:....   |.....:::::|       :|....:||  .|:..:....|.|..  |...
Mouse    46 GPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSL--HGLAASAPPQDSSSKSPEPSA 108

  Fly   518 EEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLI 582
            :|..|:..:..| |||||       .|||||||||:|||||||||||||||||||||||||||||
Mouse   109 DESPDNDKETQG-GGGDA-------GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLI 165

  Fly   583 RLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPC 647
            |||||||||||||||||.|||:.|||.|..|               ||||||||||||||:||||
Mouse   166 RLTPTQVKIWFQNHRYKMKRARAEKGMEVTP---------------LPSPRRVAVPVLVRDGKPC 215

  Fly   648 LGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGH--- 709
                                       |.|.|.:.|||...|....:...|.:..|...:..   
Mouse   216 ---------------------------HALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSS 253

  Fly   710 --------GHPHAHAQRAAW 721
                    .||...||:..|
Mouse   254 ASTPQYPTAHPLVQAQQWTW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 51/52 (98%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 14/47 (30%)
Homeobox 131..185 CDD:395001 51/53 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I6029
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - oto92721
orthoMCL 1 0.900 - - OOG6_108087
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2570
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.