DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NKX2-3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_660328.2 Gene:NKX2-3 / 159296 HGNCID:7836 Length:364 Species:Homo sapiens


Alignment Length:326 Identity:111/326 - (34%)
Similarity:161/326 - (49%) Gaps:62/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 SPVTS-----------EVSYTYI-GSNCQ--------TSPAL--SGDYKSYSRSADSDALSVGDA 459
            |||||           |..:.:. |::.|        ::|.:  :.:...:|...:.|....|:.
Human     5 SPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEK 69

  Fly   460 ---LHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDI 521
               |::|..:.|:|.:|..|..:......::.:....|..:.|.:      .|.|.....:::.:
Human    70 LSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVV------RDRSQKSCQLKKSL 128

  Fly   522 DDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTP 586
            :...|...:    .......|..:||.||||::||.:||||||:|||||||||||||||.::||.
Human   129 ETAGDCKAA----EESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTS 189

  Fly   587 TQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDS 651
            |||||||||.|||.||.:.:|..|     |..||..       |.|||||||||||:||||:..|
Human   190 TQVKIWFQNRRYKCKRQRQDKSLE-----LGAHAPP-------PPPRRVAVPVLVRDGKPCVTPS 242

  Fly   652 SK-------LGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGH 709
            ::       :||...|.:|..|....|:||        |||...||||||..::.::..|:..|.
Human   243 AQAYGAPYSVGASAYSYNSFPAYGYGNSAA--------AAAAAAAAAAAAAAYSSSYGCAYPAGG 299

  Fly   710 G 710
            |
Human   300 G 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 41/52 (79%)
NKX2-3NP_660328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..153 4/24 (17%)
HOX 148..204 CDD:197696 43/55 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12127
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.