DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Hoxd4

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:76 Identity:29/76 - (38%)
Similarity:41/76 - (53%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 NGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKT 600
            |.:.|.|   ::.|..:|:.|..|||:.|...|||:...|..:|..:.|:..|:||||||.|.|.
Mouse   146 NYTGGEP---KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKW 207

  Fly   601 K---RAQNEKG 608
            |   :..|.||
Mouse   208 KKDHKLPNTKG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 23/58 (40%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126
Antp-type hexapeptide 131..136
Homeodomain 153..209 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.