DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NKX2-5

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_004378.1 Gene:NKX2-5 / 1482 HGNCID:2488 Length:324 Species:Homo sapiens


Alignment Length:175 Identity:78/175 - (44%)
Similarity:94/175 - (53%) Gaps:48/175 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKG 608
            ::||.||||::||.|||||||:||||||||||:.|||:::||.|||||||||.|||.||.:.::.
Human   137 RRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQT 201

  Fly   609 YE--GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKL----------------- 654
            .|  |.|            |...|..||:|||||||:||||||||:..                 
Human   202 LELVGLP------------PPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYP 254

  Fly   655 ------GADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAA 693
                  ||.|....|.||....           |.:..|.|.|||
Human   255 AYPGYGGAACSPGYSCTAAYPA-----------GPSPAQPATAAA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)
NKX2-5NP_004378.1 Homeobox 145..194 CDD:278475 37/48 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12127
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.