DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NKX2-6

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:284 Identity:104/284 - (36%)
Similarity:128/284 - (45%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 DALSVGDALHTLHGSSG----NGS-AGGAPTAHALHNNNNNTTNNNNHSLKAE-------GINGA 504
            ||...|..:|...|..|    :|| ..|.|....|             .:.||       |:|.|
Human    47 DAEPRGSEVHNAGGGGGDRKLDGSEPPGGPCEAVL-------------EMDAERMGEPQPGLNAA 98

  Fly   505 GS-GHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNK---KRKRRVLFTKAQTYELERRFR 565
            .. |....:.|.|:           |:.|....|......|   :||.||||::||...|||||:
Human    99 SPLGGGTRVPERGV-----------GNSGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFK 152

  Fly   566 QQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSA 628
            |||||||||||||||.::||.|||||||||.|||.||.:.:|..|  |||               
Human   153 QQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHP--------------- 202

  Fly   629 LPSPRRVAVPVLVRNGKPCLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAA 693
             .:|||||||||||:||||||...  ||.......:.|.:..:....:..|..||......|.|.
Human   203 -LTPRRVAVPVLVRDGKPCLGPGP--GAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAP 264

  Fly   694 AGLHAHAHAHAHAHGHGHPHAHAQ 717
            :|...|....:...|||..:|..|
Human   265 SGPAPHTPLASAGFGHGGQNATPQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 24/111 (22%)
HOX 132..188 CDD:197696 42/55 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143178
Domainoid 1 1.000 46 1.000 Domainoid score I12127
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.