DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx3-2

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_031550.2 Gene:Nkx3-2 / 12020 MGIID:108015 Length:333 Species:Mus musculus


Alignment Length:323 Identity:97/323 - (30%)
Similarity:136/323 - (42%) Gaps:100/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 GEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDE--MSSYHHMAQTMLQHS 393
            ||.::.| ...|...||||   .|....|.||...:     ||.:..:  :|..:...:......
Mouse    56 GETEAGA-LGGAEDSLLAS---PARTRTAVGQSAES-----PGGWDSDSALSEENEGRRRCADVP 111

  Fly   394 GRSAWIKENELYGTQQP-----ASPD--STSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADS 451
            |.|...:.....|..||     |:.|  ..:||.|:         .:.|.::|||   :|...:.
Mouse   112 GASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSD---------SEMSASVSGD---HSPRGED 164

  Fly   452 DALSVGDA-LHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNED 515
            |::|.|.| :..|.|::|:|::||.                            ||          
Mouse   165 DSVSPGGARVPGLRGAAGSGASGGQ----------------------------AG---------- 191

  Fly   516 GIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLAS 580
            |:||:.:.....              |.|||. |..|:.||.:||||||..|||||.|||..||:
Mouse   192 GVEEEEEPAAPK--------------PRKKRS-RAAFSHAQVFELERRFNHQRYLSGPERADLAA 241

  Fly   581 LIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRN 643
            .::||.|||||||||.||||||.|..      ..||          ::.|:.::|||.||||:
Mouse   242 SLKLTETQVKIWFQNRRYKTKRRQMA------ADLL----------ASAPAAKKVAVKVLVRD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 34/52 (65%)
Nkx3-2NP_031550.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..121 9/51 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..212 29/139 (21%)
Homeobox 209..262 CDD:278475 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.