DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-5

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_446103.2 Gene:Nkx2-5 / 114109 RGDID:620520 Length:319 Species:Rattus norvegicus


Alignment Length:196 Identity:83/196 - (42%)
Similarity:109/196 - (55%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 DVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPT 587
            ::|.|:..|......     .::||.||||::||.|||||||:||||||||||:.|||:::||.|
  Rat   120 ELDKAETDGAERPRA-----RRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTST 179

  Fly   588 QVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGD 650
            ||||||||.|||.||.:.::..|  |.|.               |..||:|||||||:|||||||
  Rat   180 QVKIWFQNRRYKCKRQRQDQTLELLGPPP---------------PPARRIAVPVLVRDGKPCLGD 229

  Fly   651 SSK------LGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGH 709
            |:.      :|.:....::........||..  .|.:.||||..|..||....|.|:::....|.
  Rat   230 SAAYAPAYGVGLNAYGYNAYPYPGYGGAACS--PAYSCAAAYPAAPPAAQPPAAAANSNFVNFGV 292

  Fly   710 G 710
            |
  Rat   293 G 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)
Nkx2-5NP_446103.2 Homeobox 144..194 CDD:395001 37/49 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11893
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.