DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and LOC11175880

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_061500639.1 Gene:LOC11175880 / 11175880 VectorBaseID:AGAMI1_003908 Length:523 Species:Anopheles gambiae


Alignment Length:35 Identity:9/35 - (25%)
Similarity:18/35 - (51%) Gaps:7/35 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 SPKY---AKLSNSSTALRVIF----GVSIICIIFS 175
            :|||   .:|||....:::.:    |..::|..:|
Mosquito    46 TPKYRLIVRLSNKDITVQIAYARIEGDRVVCAAYS 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649
LOC11175880XP_061500639.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.