DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2-4

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_002939478.1 Gene:nkx2-4 / 100495653 XenbaseID:XB-GENE-487481 Length:343 Species:Xenopus tropicalis


Alignment Length:320 Identity:109/320 - (34%)
Similarity:147/320 - (45%) Gaps:70/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 GSFGDEMSSYH--HMAQT-MLQHS-GRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQ 433
            |:....:.:|.  |::|| |.||| |.:|.:       |.....|.|    .|:.|:..:|..|.
 Frog    34 GNLSSPLGAYRQTHVSQTGMQQHSMGHNATV-------TTTYHMPHS----VSQFSHGAMGGYCN 87

  Fly   434 TSPALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKA 498
            ......||..||..:..:.|.:.|     .:|:                |.:...:..:.....:
 Frog    88 GGIGNMGDIPSYQDTMRNSAAATG-----WYGA----------------NTDPRYSTISRFMGPS 131

  Fly   499 EGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERR 563
            .|:|.||.|     ...||.|....:.....:             .:|||||||::||.||||||
 Frog   132 TGMNMAGMG-----TLQGIAEAAKSMAPLHAA-------------PRRKRRVLFSQAQVYELERR 178

  Fly   564 FRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSA 628
            |:||:||||||||||||:|.||||||||||||||||.||...:|        :........:...
 Frog   179 FKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDK--------VTQQLQQESNLCQ 235

  Fly   629 LPSPRRVAVPVLVRNGKPCLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQH 688
            ..|||||||||||::||||...|:      .|..:...|..|:.|...|.:.|  |.:||
 Frog   236 QQSPRRVAVPVLVKDGKPCQNSSN------TSTPNQQVTQQQSGATGGLSSSN--AVHQH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
nkx2-4XP_002939478.1 Homeobox 163..217 CDD:365835 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.