DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2-3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_002937234.1 Gene:nkx2-3 / 100486189 XenbaseID:XB-GENE-852996 Length:328 Species:Xenopus tropicalis


Alignment Length:202 Identity:87/202 - (43%)
Similarity:113/202 - (55%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 GAGSGHDD-SLNEDGI-------EEDIDDVDDADGSGGG---------DANGSDGLPNK-----K 545
            ||...|.| .|:.|..       ||| ::.:|:...||.         |..|....|::     :
 Frog    83 GAAEPHGDVGLSPDRYVALRDPKEED-EEEEDSLREGGNKSCFLNKSPDGEGKLEDPDRPKQRSR 146

  Fly   546 RKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE 610
            ||.||||::||.:||||||:||||||||||||||:.::||.|||||||||.|||.||.:.:|..|
 Frog   147 RKPRVLFSQAQVFELERRFKQQRYLSAPEREHLANSLKLTSTQVKIWFQNRRYKCKRQRQDKSLE 211

  Fly   611 GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSS------KLGADCVSVSSATATAM 669
                      ...|||   |.|||||||||||:||||:|.|.      .:.|...|.:|..|.:.
 Frog   212 ----------MGTHHP---PPPRRVAVPVLVRDGKPCIGGSQSYNTAYNVTASPYSYNSYPAYSY 263

  Fly   670 QNAAAHH 676
            .|:.:::
 Frog   264 NNSPSYN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)
nkx2-3XP_002937234.1 Homeobox 149..203 CDD:365835 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.