DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx3-3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_002937227.1 Gene:nkx3-3 / 100485176 XenbaseID:XB-GENE-479908 Length:241 Species:Xenopus tropicalis


Alignment Length:240 Identity:81/240 - (33%)
Similarity:106/240 - (44%) Gaps:58/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 SPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHAL 481
            ||:||......:...|:                ||:.           |:.||| ..|..|..|.
 Frog     7 SPLTSFSIQDILARTCR----------------DSNG-----------GNEGNG-GNGDNTGKAK 43

  Fly   482 HNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDD-------VDDADGSG------GG 533
            ..:..::|  ..||..|||.|......:..|..:..:.|.|.       ..:|..:|      .|
 Frog    44 RTDEKSST--PPHSPSAEGHNDWPQADNPPLTPEKEKTDTDSGTEDSTWEPEAASTGAYTDPSSG 106

  Fly   534 DANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRY 598
            |..| |...:.|::.|..|:.||.|||||||..|||||.|||..||:.::||.|||||||||.||
 Frog   107 DLLG-DSPKSSKKRSRAAFSHAQVYELERRFSLQRYLSGPERADLAAALKLTETQVKIWFQNRRY 170

  Fly   599 KTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRN 643
            ||||.           |:   ||.....|:|...|:|||.|||::
 Frog   171 KTKRK-----------LI---ATQTAPKSSLAPARKVAVRVLVKD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 35/52 (67%)
nkx3-3XP_002937227.1 Homeobox 120..174 CDD:365835 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.