DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2-1

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_002935383.1 Gene:nkx2-1 / 100135015 XenbaseID:XB-GENE-485985 Length:346 Species:Xenopus tropicalis


Alignment Length:345 Identity:120/345 - (34%)
Similarity:147/345 - (42%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 SPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADSDA-----LS-------VGDALHTLH 464
            ||..|:|.:             .|..||...:||.:.|...|     ||       |..|....|
 Frog     4 SPKHTTPFS-------------VSDILSPLEESYKKVAMESAGLGAPLSAAYRQSQVSQASMQQH 55

  Fly   465 GSSGNG--------SAGGAP-TAHALHNN--NNNTTNNNNHS-----------LKAEGINGAG-- 505
            |...||        :|.|.| .:|.....  |.|..|..|.|           ..|.|..||.  
 Frog    56 GMGHNGPVSAAYHMTAAGVPQLSHTTMGGYCNGNLGNLGNMSELPPYQDTMRNSSATGWYGANPD 120

  Fly   506 ---------SGHDDSLNEDGIEEDIDDVDDADGSGG--GDANGSDGLP---NKKRKRRVLFTKAQ 556
                     .|....:|..|:           |:.|  ||. |....|   ..:|||||||::||
 Frog   121 PRFSTISRFMGPSSGMNMGGL-----------GNMGSLGDV-GKSMTPLQATPRRKRRVLFSQAQ 173

  Fly   557 TYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHAT 621
            .|||||||:||:||||||||||||:|.||||||||||||||||.||...:|..:......:....
 Frog   174 VYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQMQQDNSSCQ 238

  Fly   622 HPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAY 686
            ...      |||||||||||::||||...|:...|...|....||||:       .|..||...:
 Frog   239 QQQ------SPRRVAVPVLVKDGKPCQAGSNTPTAALQSHQQQTATAI-------TVTSNGLGPH 290

  Fly   687 QHAAAAAAGLHAHAHAHAHA 706
            |.....:||.......|:::
 Frog   291 QSHQTNSAGQSPDLVPHSNS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
nkx2-1XP_002935383.1 Homeobox 165..219 CDD:365835 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.