DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2-2

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_002939477.1 Gene:nkx2-2 / 100038077 XenbaseID:XB-GENE-482219 Length:271 Species:Xenopus tropicalis


Alignment Length:274 Identity:117/274 - (42%)
Similarity:137/274 - (50%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 PALSGDYKSYSRSADSDALSVGDALHTLHGSSGNG-----SAGGAPTAHALHNNNNN-------T 488
            |..:.|..|.:..||.|.    |.........|.|     :....|.....:::::|       |
 Frog    19 PDTNDDEGSIAEGADEDT----DGSEPTKKPRGLGQSPLETVQSLPLKSPFYDSSDNPYTRWLAT 79

  Fly   489 TNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFT 553
            |.:..:||  .|...:.|..|.|........|....:|.|.|...|:       .|||||||||:
 Frog    80 TESIQYSL--HGFASSNSQQDSSPKSPEPSADESPDNDKDPSTNPDS-------GKKRKRRVLFS 135

  Fly   554 KAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHG 618
            ||||||||||||||||||||||||||||||||||||||||||||||.|||:.|||.|..|     
 Frog   136 KAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTP----- 195

  Fly   619 HATHPHHPSALPSPRRVAVPVLVRNGKPC-------LGDSSKLGADCVSVSSATATAMQ------ 670
                      ||||||||||||||:||||       |..:...|....:.|:.:...||      
 Frog   196 ----------LPSPRRVAVPVLVRDGKPCHTLKAQDLAATFPAGIPFSAYSAQSLQHMQYNAQYS 250

  Fly   671 ---NA---AAHHLV 678
               ||   .|||||
 Frog   251 SASNAQYPTAHHLV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 51/52 (98%)
nkx2-2XP_002939477.1 LAP1C 21..>149 CDD:368520 44/140 (31%)
COG5576 93..216 CDD:227863 89/144 (62%)
Homeobox 130..184 CDD:365835 51/53 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5983
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072653at2759
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - oto103007
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2570
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.