DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and Eppin

DIOPT Version :10

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:108 Identity:32/108 - (29%)
Similarity:39/108 - (36%) Gaps:27/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQVQAAS------PRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKK------TTGPTCLRDKM 75
            |:||..|      ||..|:....||    :|.:.|....|   |..||      ..|..||..:.
Mouse    17 ARVQGPSLADLLFPRRCPRFREECE----HQERDLCTRDR---DCPKKEKCCVFNCGKKCLNPQQ 74

  Fly    76 DLLD------YCKKAYPNRDITNIVESSHYQKIGGWCRQGALN 112
            |:..      || .||..|...|...|:....|.|.| ||..|
Mouse    75 DICSLPKDSGYC-MAYFRRWWFNKENSTCQVFIYGGC-QGNNN 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 30/105 (29%)
APP_E2 388..580 CDD:463752
DDRGK 632..>682 CDD:370664
APP_amyloid 834..887 CDD:463129
EppinNP_083601.1 WAP 30..72 CDD:459672 14/48 (29%)
Kunitz_eppin 75..131 CDD:438654 14/43 (33%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 6/15 (40%)
Interaction with LTF. /evidence=ECO:0000250 117..133
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.