DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and HHIP

DIOPT Version :10

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_071920.1 Gene:HHIP / 64399 HGNCID:14866 Length:700 Species:Homo sapiens


Alignment Length:171 Identity:34/171 - (19%)
Similarity:55/171 - (32%) Gaps:74/171 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KKTTGPTC-LRDKMDLLDYCKKAYPNRDITNIVESSHYQKIGGWCRQ----------GALNAAKC 116
            |:..||.. ..|:|:..|            .:.|.|...|...:|.|          |||::.  
Human   186 KQVRGPASNYLDQMEEYD------------KVEEISRKHKHNCFCIQEVVSGLRQPVGALHSG-- 236

  Fly   117 KGSHR--------WIKPFRCLGPFQSDALLVPEGCLFDHIHNASRCWPFV---RWNQTGAAACQE 170
            .||.|        ::|            :|.|||.:|..        |::   :..|:|.....|
Human   237 DGSQRLFILEKEGYVK------------ILTPEGEIFKE--------PYLDIHKLVQSGIKGGDE 281

  Fly   171 RGMQMRSFAMLLPCGISVFSGVEFVCCPKHFKTDEIHVKKT 211
            ||:...:|.                  |.:.|..:::|..|
Human   282 RGLLSLAFH------------------PNYKKNGKLYVSYT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 30/156 (19%)
APP_E2 388..580 CDD:463752
DDRGK 632..>682 CDD:370664
APP_amyloid 834..887 CDD:463129
HHIPNP_071920.1 Folate_rec 38..220 CDD:397250 10/45 (22%)
YliI 217..583 CDD:441736 25/128 (20%)
Interaction with SHH zinc binding site 376..388
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.