DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Appl and tfpi2

DIOPT Version :9

Sequence 1:	NP_001245448.1	Gene:	Appl / 31002	FlyBaseID:	FBgn0000108	Length:	890	Species:	Drosophila melanogaster
Sequence 2:	NP_001035185.1	Gene:	tfpi2 / 560339	ZFINID:	ZDB-GENE-060503-38	Length:	233	Species:	Danio rerio

Alignment Length:	131	Identity:	26/131 - (19%)
Similarity:	41/131 - (31%)	Gaps:	51/131 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 PQIAVLCEAGQIYQPQYLSEEG-------RWVTDLSKKTTGP----TC------LRDKMDLLDYC 81
            |:|..:|        ::..:||       |:..:::.....|    .|      .|:..:.::||
Zfish    84 PKIPQIC--------RFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYC 140

  Fly    82 K--KAYP-----NRD---------------ITNIVESSHYQKIGGWCRQGALNAAKCK---GSHR 121
            |  |..|     |.|               .|...|...|...|| .....::...|.   ||.|
Zfish   141 KPPKTIPVICLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGG-SNNNFISKQSCVDVCGSKR 204

  Fly   122 W 122
            |
Zfish   205 W 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Appl	NP_001245448.1	A4_EXTRA	26..198	CDD:128326	26/131 (20%)
		APP_N	33..141	CDD:280358	26/131 (20%)
		APP_Cu_bd	143..198	CDD:289676
		APP_E2	387..580	CDD:289677
		GBP_C	<629..682	CDD:303769
		APP_amyloid	834..887	CDD:287486
tfpi2	NP_001035185.1	KU	28..80	CDD:197529
		Kunitz_BPTI	89..141	CDD:278443	8/59 (14%)
		Kunitz_BPTI	149..201	CDD:278443	8/52 (15%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900