DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and Y55F3BR.11

DIOPT Version :10

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_001041041.2 Gene:Y55F3BR.11 / 4363075 WormBaseID:WBGene00044757 Length:125 Species:Caenorhabditis elegans


Alignment Length:40 Identity:13/40 - (32%)
Similarity:17/40 - (42%) Gaps:13/40 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWV 58
            ||...|||||.     |.|::        |.:.|..|.|:
 Worm    57 AIAVDQVQAAI-----QTALI--------PNFASSGGTWL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 9/33 (27%)
APP_E2 388..580 CDD:463752
DDRGK 632..>682 CDD:370664
APP_amyloid 834..887 CDD:463129
Y55F3BR.11NP_001041041.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.