DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and Spint5p

DIOPT Version :9

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_001008881.1 Gene:Spint5p / 408232 RGDID:1302989 Length:167 Species:Rattus norvegicus


Alignment Length:130 Identity:24/130 - (18%)
Similarity:44/130 - (33%) Gaps:51/130 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 NAAKCKGSH--RWIKPFRCLGPFQSDALLVPEG-----CLFDHI---------HNASRCWPFVRW 160
            :|.:..|.|  .|:..|..|.|..|..|:.|.|     |...|:         |...|.:.:. :
  Rat    23 SAMEAPGIHLALWLLTFTMLLPMLSTELMFPPGVRNQLCESGHLGCNQPVKKGHCTFRFYRYY-F 86

  Fly   161 NQTGAAACQERGMQMRSFAMLLPCGISVFSGV---------EFVCCPKHFKTDEIHVKKTDLPVM 216
            |:..|.                 |.:.:|||.         :::|        |:|..:.::.::
  Rat    87 NKDTAL-----------------CELFIFSGCGGNRNNFKSKYLC--------ELHCIEVEVSLL 126

  Fly   217  216
              Rat   127  126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 22/110 (20%)
APP_N 33..141 CDD:280358 9/30 (30%)
APP_Cu_bd 143..198 CDD:289676 11/72 (15%)
APP_E2 387..580 CDD:289677
GBP_C <629..682 CDD:303769
APP_amyloid 834..887 CDD:287486
Spint5pNP_001008881.1 KU 68..118 CDD:197529 10/75 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.