DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and CG3604

DIOPT Version :9

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:99 Identity:20/99 - (20%)
Similarity:37/99 - (37%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 EKLREEKLRLEAKKVDDMLKSQVAEQQSQPTQS------------STQSQAQQQ-------QQEK 701
            ||..|..:   ||.:.|..:..|.|...||.::            :..:|:.::       ..:.
  Fly    32 EKAEEPAV---AKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKN 93

  Fly   702 SLPGKELGPDAALVTAANPNLETTKSEKDLSDTE 735
            :...||....|.||.:|..:.::|..:.....||
  Fly    94 NFESKEQCEQACLVKSAVSSTDSTTEQNSEVATE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326
APP_N 33..141 CDD:280358
APP_Cu_bd 143..198 CDD:289676
APP_E2 387..580 CDD:289677
GBP_C <629..682 CDD:303769 8/25 (32%)
APP_amyloid 834..887 CDD:287486
CG3604NP_001285595.1 KU 53..106 CDD:238057 7/52 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.