DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Appl and hhip

DIOPT Version :9

Sequence 1:	NP_001245448.1	Gene:	Appl / 31002	FlyBaseID:	FBgn0000108	Length:	890	Species:	Drosophila melanogaster
Sequence 2:	NP_001073481.1	Gene:	hhip / 326102	ZFINID:	ZDB-GENE-030131-4827	Length:	693	Species:	Danio rerio

Alignment Length:	140	Identity:	30/140 - (21%)
Similarity:	45/140 - (32%)	Gaps:	64/140 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 GQIY------QPQYLSEEGRWVTDLSKKTT------------------------GPTCLRDKMDL 77
            |:||      :||...|..|.|.|....:|                        ||.|||.|.:|
Zfish   569 GKIYKLVDPKRPQVPKECRRPVEDPEMLSTACSRECKNGHCTPTGKCCCNAGWEGPFCLRAKCEL 633

  Fly    78 LDYCKK----AYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGPFQSDALL 138
            .  |:.    ..||:.:               |::| .:..:|....|..|     |..:.|::|
Zfish   634 A--CRNGGVCVEPNKCL---------------CKEG-FSGNQCSKGERGTK-----GDGEKDSIL 675

  Fly   139 VPEGCLFDHI 148
                   :||
Zfish   676 -------EHI 678

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Appl	NP_001245448.1	A4_EXTRA	26..198	CDD:128326	30/140 (21%)
		APP_N	33..141	CDD:280358	28/131 (21%)
		APP_Cu_bd	143..198	CDD:289676	2/6 (33%)
		APP_E2	387..580	CDD:289677
		GBP_C	<629..682	CDD:303769
		APP_amyloid	834..887	CDD:287486
hhip	NP_001073481.1	Folate_rec	36..212	CDD:281076
hhip	NP_001073481.1	GSDH	218..>420	CDD:285269
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900