DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and Spint1

DIOPT Version :9

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:396 Identity:82/396 - (20%)
Similarity:128/396 - (32%) Gaps:139/396 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EEGRWVTDLSKKTTGPTCLRDKMDLL----------DYCKKAYPNRDITNIVESSHYQKIGGWCR 107
            :||.::..|::  |....|.:.::|.          |||..:|               |:|    
  Rat   208 KEGTYLFQLTR--TDSDQLEETVNLTITVLTAEQTEDYCLASY---------------KVG---- 251

  Fly   108 QGALNAAKCKGSH-RW--------IKPFR---CLGPFQSDALLVPEGCLFDHIHNASRCWPFVRW 160
                   :|:||. ||        .|.|.   |||  ..:..|..|.|:.               
  Rat   252 -------RCRGSFPRWYYDPKEQICKSFTFGGCLG--NKNNYLREEECML--------------- 292

  Fly   161 NQTGAAACQE-RGMQMRSFAMLLPCGISVFSGVEFV----CCPKHFKTDEIHVKKTDLPVMPAAQ 220
                  ||:: :|:..:....:  |..|..| .:|.    ||...|      ::..|.|..|   
  Rat   293 ------ACKDVKGISPKRHHPV--CTGSCHS-TQFQCSNGCCIDGF------LECDDTPDCP--- 339

  Fly   221 INSANDELVMNDEDDSNDSNYSKDANEDDLDDEDDLMGDDEEDDM--VADEAATAGGSPNTGSSG 283
                      :..|::....||.              |.||...:  ::|:...| ..|:||.  
  Rat   340 ----------DGSDEATCEKYSS--------------GFDELQSIHFLSDKGYCA-ELPDTGF-- 377

  Fly   284 DSNSGSLDDINAEYDS--GEEGDNYEEDGA-GSESEAEVEASWDQS--GGAK--VVSLKSDSSSP 341
                 ..::|...|.:  .|....:...|. |:::..|.|....:|  |.:|  |..|:.:||.|
  Rat   378 -----CKENIPRWYYNPFSERCARFTYGGCYGNKNNFEKEQQCLESCRGISKKDVFGLRRESSVP 437

  Fly   342 SSAPVAPAPEKAPVKSESVTSTPQLSASAAAFVAANSGNSGTGAGAPPSTAQPTSDPYFTHFDPH 406
            |:..|    |.|.....:|.....|:.....|......|..:....||.|  |.|....|..|. 
  Rat   438 SAGSV----EVAIAVLLAVCIIVVLTILGYCFFKNQKKNFHSPLHQPPPT--PASSTVSTTEDT- 495

  Fly   407 YEHQSY 412
             ||..|
  Rat   496 -EHLVY 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 33/171 (19%)
APP_N 33..141 CDD:280358 23/109 (21%)
APP_Cu_bd 143..198 CDD:289676 9/59 (15%)
APP_E2 387..580 CDD:289677 10/26 (38%)
GBP_C <629..682 CDD:303769
APP_amyloid 834..887 CDD:287486
Spint1NP_001004265.2 MANEC 44..133 CDD:284837
Kunitz_BPTI 243..295 CDD:278443 19/100 (19%)
LDLa 313..344 CDD:197566 8/50 (16%)
Kunitz_BPTI 368..420 CDD:278443 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.