DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and Spint2

DIOPT Version :9

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:194 Identity:46/194 - (23%)
Similarity:70/194 - (36%) Gaps:66/194 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALRRNLLL-------RSLWVVLAIGTAQV----QAASPRW---------EPQIAVLCEAGQIYQP 48
            ||..:|||       |.|.|..:.|.::|    :|:.|||         :|.:...||......|
  Rat    15 ALLASLLLSGAQAASRDLDVHESCGVSKVVGKCRASIPRWWYNVTDGTCQPFVYGGCEGNGNNYP 79

  Fly    49 QYLSEE---------GRWVTDLSKKTTGPTCL-----RDKMDLL-------DY---------CKK 83
            .  .||         ...:..|::.:.|.:.|     :|..||.       :|         |:.
  Rat    80 S--KEECLDKCAGITENTIDGLARSSDGASALSVPRKQDSADLAGEIFNYEEYCVPKAVTGPCRA 142

  Fly    84 AYPNRDITNIVESSHYQKIGGWCRQGALNA--------AKCKGSHRWIKPFRCLGPFQSDALLV 139
            |:| |...::.::|....|.|.|| |..|:        ..|.|...:  ||  |.|.....:||
  Rat   143 AFP-RWYYDVEKNSCSSFIYGGCR-GNKNSYLSQEACMQHCSGKQMY--PF--LTPGTKAVILV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 36/161 (22%)
APP_N 33..141 CDD:280358 32/145 (22%)
APP_Cu_bd 143..198 CDD:289676
APP_E2 387..580 CDD:289677
GBP_C <629..682 CDD:303769
APP_amyloid 834..887 CDD:287486
Spint2NP_001076018.1 Kunitz_BPTI 38..88 CDD:278443 12/51 (24%)
Kunitz_BPTI 130..181 CDD:278443 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.