DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Appl and Tfpi

DIOPT Version :9

Sequence 1:	NP_001245448.1	Gene:	Appl / 31002	FlyBaseID:	FBgn0000108	Length:	890	Species:	Drosophila melanogaster
Sequence 2:	NP_001342200.1	Gene:	Tfpi / 21788	MGIID:	1095418	Length:	306	Species:	Mus musculus

Alignment Length:	135	Identity:	33/135 - (24%)
Similarity:	43/135 - (31%)	Gaps:	42/135 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 VQAASPRWEPQIAVLCEAGQI---YQPQYLSEEGRWVTDLSKKTTGPTCL--RDKMDLLDYCKKA 84
            |:|||....|....|.|...:   |..:||...   .|...::.....||  |:..:.||.|||.
Mouse   109 VKAASGAERPDFCFLEEDPGLCRGYMKRYLYNN---QTKQCERFVYGGCLGNRNNFETLDECKKI 170

  Fly    85 YPN----RDITNIVESSHYQKIGG-----------------------------WCRQGALNAAKC 116
            ..|    ....|.|:.|.|...|.                             ||.|.| ::..|
Mouse   171 CENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPA-DSGLC 234

  Fly   117 KGSHR 121
            |.|.|
Mouse   235 KASER 239

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Appl	NP_001245448.1	A4_EXTRA	26..198	CDD:128326	32/134 (24%)
		APP_N	33..141	CDD:280358	29/127 (23%)
		APP_Cu_bd	143..198	CDD:289676
		APP_E2	387..580	CDD:289677
		GBP_C	<629..682	CDD:303769
		APP_amyloid	834..887	CDD:287486
Tfpi	NP_001342200.1	KU	48..101	CDD:238057
		Kunitz_BPTI	120..171	CDD:394972	14/53 (26%)
		Kunitz_BPTI	224..276	CDD:394972	8/17 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900