Sequence 1: | NP_001245448.1 | Gene: | Appl / 31002 | FlyBaseID: | FBgn0000108 | Length: | 890 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509868.1 | Gene: | C34F6.1 / 181306 | WormBaseID: | WBGene00007938 | Length: | 1043 | Species: | Caenorhabditis elegans |
Alignment Length: | 237 | Identity: | 52/237 - (21%) |
---|---|---|---|
Similarity: | 74/237 - (31%) | Gaps: | 71/237 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 YLSEEGRWVTDLSKKTTGPTCLRDKMDLLDYCKKAYPNRDIT------------NIVESSHYQKI 102
Fly 103 GGWCRQGALNAAKCKGSHRWIKPFRCLGPFQSDALLVPEGC--------LFDHIHNASRCWPF-- 157
Fly 158 --VRWNQ-------TGAAACQE------RGMQMRSFAMLLPCGISVFSGVEFVCCPKHFKTD-EI 206
Fly 207 HVKKTDLPVMPAAQINSANDELVMNDEDDSNDSNYSKDANED 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Appl | NP_001245448.1 | A4_EXTRA | 26..198 | CDD:128326 | 40/184 (22%) |
APP_N | 33..141 | CDD:280358 | 19/102 (19%) | ||
APP_Cu_bd | 143..198 | CDD:289676 | 19/79 (24%) | ||
APP_E2 | 387..580 | CDD:289677 | |||
GBP_C | <629..682 | CDD:303769 | |||
APP_amyloid | 834..887 | CDD:287486 | |||
C34F6.1 | NP_509868.1 | Lustrin_cystein | 186..231 | CDD:291299 | |
Kunitz_BPTI | 238..289 | CDD:278443 | |||
Lustrin_cystein | 301..343 | CDD:291299 | |||
Kunitz_BPTI | 351..403 | CDD:278443 | |||
Kunitz_BPTI | 456..512 | CDD:278443 | |||
KU | 564..617 | CDD:238057 | |||
Lustrin_cystein | 623..663 | CDD:291299 | |||
KU | 667..720 | CDD:238057 | |||
Lustrin_cystein | 726..767 | CDD:291299 | |||
Kunitz_BPTI | 772..824 | CDD:278443 | 4/20 (20%) | ||
Lustrin_cystein | 829..873 | CDD:291299 | 10/55 (18%) | ||
KU | 878..931 | CDD:238057 | 15/57 (26%) | ||
Lustrin_cystein | 937..977 | CDD:291299 | 7/42 (17%) | ||
Kunitz_BPTI | 982..1033 | CDD:278443 | 9/29 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4295 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |