powered by:
Protein Alignment Appl and WFDC13
DIOPT Version :9
Sequence 1: | NP_001245448.1 |
Gene: | Appl / 31002 |
FlyBaseID: | FBgn0000108 |
Length: | 890 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_742002.1 |
Gene: | WFDC13 / 164237 |
HGNCID: | 16131 |
Length: | 93 |
Species: | Homo sapiens |
Alignment Length: | 98 |
Identity: | 26/98 - (26%) |
Similarity: | 37/98 - (37%) |
Gaps: | 40/98 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 IKPFRCLGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQ-MRSFAMLLPCGI 186
::|..|:. .||.| .|: | |....| |:|.| ..|| |||
Human 33 LEPPPCIS--------APENC--THL-----C--------TMQEDC-EKGFQCCSSF-----CGI 68
Fly 187 SVFSGVEFVCCPKHF-KTDEIHVKKTDLPVMPA 218
||..:.| |.:.|..|.::: :|||
Human 69 --------VCSSETFQKRNRIKHKGSEV-IMPA 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.