DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Appl and WFDC13

DIOPT Version :10

Sequence 1:NP_001245448.1 Gene:Appl / 31002 FlyBaseID:FBgn0000108 Length:890 Species:Drosophila melanogaster
Sequence 2:NP_742002.1 Gene:WFDC13 / 164237 HGNCID:16131 Length:93 Species:Homo sapiens


Alignment Length:98 Identity:26/98 - (26%)
Similarity:37/98 - (37%) Gaps:40/98 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IKPFRCLGPFQSDALLVPEGCLFDHIHNASRCWPFVRWNQTGAAACQERGMQ-MRSFAMLLPCGI 186
            ::|..|:.        .||.|  .|:     |        |....| |:|.| ..||     |||
Human    33 LEPPPCIS--------APENC--THL-----C--------TMQEDC-EKGFQCCSSF-----CGI 68

  Fly   187 SVFSGVEFVCCPKHF-KTDEIHVKKTDLPVMPA 218
                    ||..:.| |.:.|..|.::: :|||
Human    69 --------VCSSETFQKRNRIKHKGSEV-IMPA 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ApplNP_001245448.1 A4_EXTRA 26..198 CDD:128326 19/75 (25%)
APP_E2 388..580 CDD:463752
DDRGK 632..>682 CDD:370664
APP_amyloid 834..887 CDD:463129
WFDC13NP_742002.1 WFDC domain 38..70 16/68 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.