DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4293 and Ergic3

DIOPT Version :9

Sequence 1:NP_001033816.1 Gene:CG4293 / 31001 FlyBaseID:FBgn0024983 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001343342.1 Gene:Ergic3 / 66366 MGIID:1913616 Length:394 Species:Mus musculus


Alignment Length:413 Identity:101/413 - (24%)
Similarity:175/413 - (42%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNLDAFKKVPEKYTETSEIGGTLSLLSRLLIVYLVYTELHYYWHETDIVYQFEPDIALD----EQ 79
            |..||:.|..|.:...:..|.|::::|.||::.|..:||.||     :..:..|::.:|    ::
Mouse     8 KQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYY-----LTTEVHPELYVDKSRGDK 67

  Fly    80 VQMHVDITVA-MPCASLSGVDLMD---ETQQDVFAYGTLQREGVWWEMSEHD----RLQFQAIQI 136
            :::::|:... ||||.|| :|.||   |.|.||                ||:    ||....:.:
Mouse    68 LKINIDVLFPHMPCAYLS-IDAMDVAGEQQLDV----------------EHNLFKKRLDKDGVPV 115

  Fly   137 QNHYLREEFHSVADVLF------------------KDI--------MRDNHPARESASKAPAAPP 175
            .:...|.|...|...:|                  :||        :|:.:..|..|.|.|.   
Mouse   116 SSEAERHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPD--- 177

  Fly   176 PGALPLSVD---LHGRHNVQPESKFDACRLHGTLGINKVAGVLHLVGGAQPVVGLFEDHWM---- 233
                  :::   ..|......|.|.:.|:::|.|.:|||||..|...|..     |:...:    
Mouse   178 ------TIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKS-----FQQSHVHVHA 231

  Fly   234 IELRRMPA------------NFTHRINRLSFGQ-YSGRIVQPLEGDEIVIHEEATTVQYFLKVVP 285
            :|:..:.:            |.||.|..||||: |.| ||.||:...:...:.:...|||:||||
Mouse   232 VEIHDLQSFGLDNPSDCLQINMTHYIKHLSFGEDYPG-IVNPLDHTNVTAPQASMMFQYFVKVVP 295

  Fly   286 T-------EIHQTFTTIYAFQYAVTENVRKLDSERNSYGSPGIYFKYDWSALKIIVRNDRDHLVT 343
            |       |:.:|      .|::||.:.:..:......|.||::..|:.|.:.:.:.........
Mouse   296 TVYMKVDGEVLRT------NQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTH 354

  Fly   344 FAIRLCSIISGIIVISGAINALL 366
            |...:|:||.|:..::|.|::|:
Mouse   355 FLTGVCAIIGGMFTVAGLIDSLI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4293NP_001033816.1 ERGIC_N 19..104 CDD:290561 27/92 (29%)
COPIIcoated_ERV <200..349 CDD:285244 45/172 (26%)
Ergic3NP_001343342.1 ERGIC_N 7..93 CDD:316374 27/90 (30%)
COPIIcoated_ERV 145..374 CDD:311775 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0445
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.