DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4293 and CG4610

DIOPT Version :9

Sequence 1:NP_001033816.1 Gene:CG4293 / 31001 FlyBaseID:FBgn0024983 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_611677.1 Gene:CG4610 / 37571 FlyBaseID:FBgn0034735 Length:661 Species:Drosophila melanogaster


Alignment Length:189 Identity:44/189 - (23%)
Similarity:67/189 - (35%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VAMPCASLSGVDLMDETQQDVFAYGTLQRE---GVWWEMSEHDRLQFQAIQIQNHYLREEFHSVA 149
            |...|..:|||.           |..|.|.   .||...::.||      |:....:::|.||..
  Fly    93 VCARCCDVSGVH-----------YKVLNRRRGPAVWGPRAQIDR------QLYKKAVQQELHSTP 140

  Fly   150 DVLFKDIMRDNHPARESASKAPAAPPPGALPLSVD-LHGRHNVQPESKFDACRLHGTLGIN-KVA 212
            ::..:....|| ...|......|....|.|..:.: :..|..|.....|  .|.|..:|:. :.|
  Fly   141 NLEIRAAAVDN-LLIEDEQDTQARRCTGVLLANGEVVRSRSVVLTTGTF--LRAHINIGLEVRPA 202

  Fly   213 GVLHLVGGAQPVVGLFE--DHWMIELRRMPANFTHRI--NRLSFGQYSGRIVQPLEGDE 267
            |.:    |..|...|.|  |.....:.|:......||  :.:.|.|     :|..|||:
  Fly   203 GRI----GDAPAKALGEAIDRLGFRMGRLKTGTPPRIAKDSVDFSQ-----LQRHEGDD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4293NP_001033816.1 ERGIC_N 19..104 CDD:290561 5/15 (33%)
COPIIcoated_ERV <200..349 CDD:285244 19/73 (26%)
CG4610NP_611677.1 PRK05192 28..661 CDD:235362 44/189 (23%)
NADB_Rossmann 33..450 CDD:304358 44/189 (23%)
GIDA_assoc 432..647 CDD:290643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0445
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.