DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4293 and MTO1

DIOPT Version :9

Sequence 1:NP_001033816.1 Gene:CG4293 / 31001 FlyBaseID:FBgn0024983 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001116698.1 Gene:MTO1 / 25821 HGNCID:19261 Length:732 Species:Homo sapiens


Alignment Length:244 Identity:49/244 - (20%)
Similarity:84/244 - (34%) Gaps:73/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 EDHWMIELRRMPANFTHRINRLSFGQYSGRIVQPLEGDEIVI-------HEEATT--------VQ 278
            |..|:....::|...||...|:               ||||:       |.:.||        ::
Human   270 ETVWIKPEDQLPCYLTHTNPRV---------------DEIVLKNLHLNSHVKETTRGPRYCPSIE 319

  Fly   279 YFLKVVPTEIHQTF--------TTIYAFQYAVT---ENVRKLDS-----ERNSYGSPGIYFKYDW 327
            ..:...|..:||.:        ..||....::|   |...|:.:     |:.....||...:||:
Human   320 SKVLRFPNRLHQVWLEPEGMDSDLIYPQGLSMTLPAELQEKMITCIRGLEKAKVIQPGYGVQYDY 384

  Fly   328 SALKIIVRNDRDHLVTFAIRLCSIISGIIVISGAINALL----LSIRSRLLRTFAPVLYNRLTRA 388
            ...:.|..:...|||.   ||        ..:|.||...    .:.::...........:.:::.
Human   385 LDPRQITPSLETHLVQ---RL--------FFAGQINGTTGYEEAAAQTECCSVARLECSDMISQL 438

  Fly   389 KAAAPDAPSLSSLSAKAGTAPPVNELLH--TANLMASVDISAYLPTTPP 435
            :|.....|||     .||||.     :|  |..::|.::.|..:...||
Human   439 QAILLPQPSL-----VAGTAG-----MHHNTQGVIAGINASLRVSRKPP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4293NP_001033816.1 ERGIC_N 19..104 CDD:290561
COPIIcoated_ERV <200..349 CDD:285244 31/150 (21%)
MTO1NP_001116698.1 PRK05192 36..710 CDD:235362 49/244 (20%)
NADB_Rossmann <358..496 CDD:304358 29/141 (21%)
GIDA_assoc 478..694 CDD:290643 49/244 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0445
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.