DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4293 and mtcu-2

DIOPT Version :9

Sequence 1:NP_001033816.1 Gene:CG4293 / 31001 FlyBaseID:FBgn0024983 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_496169.1 Gene:mtcu-2 / 174563 WormBaseID:WBGene00009944 Length:638 Species:Caenorhabditis elegans


Alignment Length:213 Identity:34/213 - (15%)
Similarity:76/213 - (35%) Gaps:82/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RGDKSNLL----EFAKNLDAFKKVPEKYTETSEIGGTLSLLSRLLIVYLVYTELHYYWHETDIVY 68
            :|:.:||.    |...::..:|::..|...||...|      ::|..:             |:::
 Worm   479 KGELNNLTQRTEEMKMSMVKWKRIIPKLAATSRNDG------KVLSAF-------------DLIH 524

  Fly    69 QFEPDIALDEQVQMHVDITVAMPCASLSGVDLMDETQQDVFAYGTLQREGVWWEMSEHDRLQFQA 133
            :::    ||:.     |:.:.:...:: |.|:::.          |:.||.:  ..||:|::.:.
 Worm   525 RYD----LDKS-----DLELCLKDKNI-GEDILER----------LKIEGRY--QMEHERMKAKK 567

  Fly   134 IQIQNHYLREEFHSVADVLFKDIMRDNHPARESASKAPAAPPPGALPLSVDLHGRHNVQPE--SK 196
            .:|.                          ||||:         |:|.:.|......:..|  .|
 Worm   568 QEID--------------------------RESAT---------AIPDNTDFSTMRGMSLECIEK 597

  Fly   197 FDACRLHGTLGINKVAGV 214
            .:..|........:::|:
 Worm   598 LERARPRNLAAATRISGI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4293NP_001033816.1 ERGIC_N 19..104 CDD:290561 12/84 (14%)
COPIIcoated_ERV <200..349 CDD:285244 2/15 (13%)
mtcu-2NP_496169.1 PRK05192 18..629 CDD:235362 34/213 (16%)
NADB_Rossmann <330..408 CDD:304358
GIDA_assoc 413..621 CDD:290643 34/213 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0445
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.