DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4293 and mto1

DIOPT Version :9

Sequence 1:NP_001033816.1 Gene:CG4293 / 31001 FlyBaseID:FBgn0024983 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_009304746.1 Gene:mto1 / 100009640 ZFINID:ZDB-GENE-070209-253 Length:695 Species:Danio rerio


Alignment Length:189 Identity:34/189 - (17%)
Similarity:55/189 - (29%) Gaps:72/189 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 VRKLDSERNSYGSPGIYFKYDWSALKIIVRN--------------DRDHLVTFAIRLCSIISGII 356
            ||::|:.....|..|     ||:.:...:.|              ||.....|..........:.
Zfish   116 VREIDALDGVMGRAG-----DWAGIHFSILNRSKGPAVWGLRAQLDRQRYKDFMQSELLSTPLVT 175

  Fly   357 VISGAINALLLS------------------------IRSRLLRTFAPVLYNRLTRAKAAAP---- 393
            ::.|::..|||:                        ..|.::.|....|...|...:...|    
Zfish   176 ILEGSVQDLLLTEADPGKPGKHKVYGICLANGGGEIHSSSVVLTTGTFLSGALFMGQNTTPGGRM 240

  Fly   394 -DAPSLSSLS-------------AKAGTAPPVNELLHTANLMASVDI---SAYLPTTPP 435
             |.||.:.||             .:.||.|.:        :..|:|.   |..||.:.|
Zfish   241 GDPPSCAGLSHNLKNVLGLKIGRLRTGTPPRI--------VKDSIDFSLTSVCLPDSSP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4293NP_001033816.1 ERGIC_N 19..104 CDD:290561
COPIIcoated_ERV <200..349 CDD:285244 11/56 (20%)
mto1XP_009304746.1 PRK05192 59..682 CDD:235362 34/189 (18%)
NADB_Rossmann <387..459 CDD:304358
GIDA_assoc 471..680 CDD:290643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0445
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.