DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and RBP45A

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:419 Identity:114/419 - (27%)
Similarity:173/419 - (41%) Gaps:102/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QQAVAAAAAAVTQQLQQQQQAVVAQQAVVQQQQQQAAAVVQQAAVQQAVVPQPQQAQPNTNGNAG 134
            ||..:.||.|  .|:...||.:   ..::||||||     ||..:..|.:.|.|.         |
plant     2 QQPPSNAAGA--GQIPSGQQHL---WMMMQQQQQQ-----QQMQLSAAPLGQHQY---------G 47

  Fly   135 SGSQNGSNGSTETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSK 199
            .||||  .||.....:|.:..|.|.|.|:.|.|:|:..||..|.|:||:|             ..
plant    48 IGSQN--PGSASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNK-------------LT 97

  Fly   200 GQSLGYGFVNYVRPQDAEQAVNVLNGLRLQN--KTIKVSFARPSSD----AIKGAN--LYVSGLP 256
            |||.||||:.:|....||:.:...||..:.:  :|.::::|:..:.    ..:|.:  ::|..|.
plant    98 GQSEGYGFIEFVSHSVAERVLQTYNGAPMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLA 162

  Fly   257 KTMTQQELEAIFA-PFGAIITSRIL--QNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSC 318
            ..:|...|...|. .:|::..::::  :..|   ::||.||:||....|..||:..:||...|  
plant   163 PEVTDYMLSDTFKNVYGSVKGAKVVLDRTTG---RSKGYGFVRFADENEQMRAMTEMNGQYCS-- 222

  Fly   319 TDPIVVKFSNTPGSTSKIIQPQLPAFLNPQLVRRIGGAMHTPVNKGLARFSPMAGDMLDVMLPNG 383
            |.|:                             |||.|    .||......|       .|..|.
plant   223 TRPM-----------------------------RIGPA----ANKNALPMQP-------AMYQNT 247

  Fly   384 LGAAAAAATTLASGPGGAYPIFIYNLAPETEEAALWQLFGPFGAVQSVKIVKDPTTNQCKGYGFV 448
            .||.|.     .:.|... .||:..|.....:..|..:||.||.:..|||   |...:|   |||
plant   248 QGANAG-----DNDPNNT-TIFVGGLDANVTDDELKSIFGQFGELLHVKI---PPGKRC---GFV 300

  Fly   449 SMTNYDEAAMAIRALNGYTMGNRVLQVSF 477
            ...|...|..|:..|||..:|.:.:::|:
plant   301 QYANKASAEHALSVLNGTQLGGQSIRLSW 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 88/343 (26%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780 28/89 (31%)
RRM2_SECp43_like 153..232 CDD:409781 25/116 (22%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.