DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and EIF3G2

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_196219.3 Gene:EIF3G2 / 830487 AraportID:AT5G06000 Length:308 Species:Arabidopsis thaliana


Alignment Length:346 Identity:79/346 - (22%)
Similarity:129/346 - (37%) Gaps:93/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SVGEIESVKLIR----DKSQVYIDPLNP--QAPSKGQS-----LGYGFVNYVRPQDAEQAVNVLN 224
            ::..|:..|.:|    |:.:...|.|.|  |..|..|:     :.|.|      .:.::.|.:..
plant     2 AIDTIQKTKKLRWGEIDEEEGDYDFLLPPKQMISPDQNGVKKVIEYKF------NEEDKKVKITT 60

  Fly   225 GLRLQNKTI-KVSFARPSSDAIKGANLYVSGLPKTMTQQE---LEAIFAPFGAIITSRILQNAGN 285
            ..|:|.:.: |.:..|.|.:....|....|....||...|   ||.|.||             |:
plant    61 TTRVQKRALTKQAVERRSWNKFGDAAHEESSSYLTMRSTEDIILERIRAP-------------GS 112

  Fly   286 DTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDP----IVVKFSNTPGS--TSKIIQPQLPAF 344
            :.             |::|     ::|.:.|....|    :|.:.....|.  ||:..|..|.:.
plant   113 NA-------------EQST-----VSGDSMSQLGKPGAVLMVCRLCQKKGDHWTSRCPQKDLLSL 159

  Fly   345 LNPQLVRRIGGAMHTPVNKGLARFSPMAGDMLDVMLPNGLGAAAAAATTLASG----PGGA---- 401
            ::..|......:..|                       |.|.||....::..|    .||:    
plant   160 MDEPLTAETSTSTIT-----------------------GTGRAAYVPPSMREGADRKAGGSDMRS 201

  Fly   402 ----YPIFIYNLAPETEEAALWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRA 462
                ..:.:.||:.:|....|.:||.|||||....:..|..|:..:|:||||..:.::|..||..
plant   202 RHDENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINK 266

  Fly   463 LNGYTMGNRVLQVSFKTNKAK 483
            ||||...|.:|:|.:.|.|.:
plant   267 LNGYGYDNLILRVEWSTPKTQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 79/344 (23%)
EIF3G2NP_196219.3 eIF3g 36..157 CDD:289149 30/157 (19%)
RRM <187..>287 CDD:223796 33/99 (33%)
RRM_eIF3G_like 207..282 CDD:240854 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.