DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and EIF3G1

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001154607.1 Gene:EIF3G1 / 820313 AraportID:AT3G11400 Length:321 Species:Arabidopsis thaliana


Alignment Length:122 Identity:37/122 - (30%)
Similarity:57/122 - (46%) Gaps:12/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 PMAGDMLDVMLPNGLGAAAAAATTLASGP------------GGAYPIFIYNLAPETEEAALWQLF 422
            |..|:...:....|.|.||....::.:|.            .....:.:.||:.:|.|..|.:||
plant   196 PPTGESSTMSAAPGTGKAAYVPPSMRAGADRSAVGSDMRRRNDENSVRVTNLSEDTREPDLMELF 260

  Fly   423 GPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGYTMGNRVLQVSFKT 479
            .|||||..|.:..|..|...:|:|||:..:.::|..||..||||...|.:|:|.:.|
plant   261 HPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWAT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 37/122 (30%)
EIF3G1NP_001154607.1 eIF3g 35..186 CDD:289149
RRM <233..>319 CDD:223796 30/85 (35%)
RRM_eIF3G_like 241..316 CDD:240854 29/74 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.