DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and Copb1

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_203534.1 Gene:Copb1 / 70349 MGIID:1917599 Length:953 Species:Mus musculus


Alignment Length:129 Identity:23/129 - (17%)
Similarity:50/129 - (38%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNY---V 211
            :::::.|....|.|.:::....:..:..:||:...|.:.:.|             :.|.|.   |
Mouse   738 DIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAP-------------HDFANIKANV 789

  Fly   212 RPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVSGL----PKTMTQQELEAIFAPF 271
            :....|      ||:...|....||.|....:.:..:::::..:    |.|.|..|...::|.|
Mouse   790 KVASTE------NGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEF 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 23/129 (18%)
Copb1NP_203534.1 Adaptin_N 18..550 CDD:366724
HEAT 1 96..131
HEAT 2 132..168
HEAT repeat 137..161 CDD:293787
HEAT repeat 173..211 CDD:293787
HEAT repeat 221..272 CDD:293787
HEAT 3 240..276
HEAT 4 277..314
HEAT repeat 280..307 CDD:293787
HEAT 5 316..353
HEAT repeat 318..342 CDD:293787
HEAT 6 396..433
Coatamer_beta_C 667..807 CDD:369484 14/87 (16%)
Coatomer_b_Cpla 813..944 CDD:373307 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S39
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.