DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and CG34354

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:478 Identity:125/478 - (26%)
Similarity:177/478 - (37%) Gaps:160/478 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TQAQLMQSAAAAAAVAATNAAAAP----------VQNAAAVAAAAQLQQQQVQQAILQVQQQQTQ 70
            |.:.||. .|...|:.|......|          :..|||.|||||.|||.|..|.||...||  
  Fly     3 TMSTLMM-PAPTIAMGAPQITMGPHKPPETKLLAIHPAAAAAAAAQQQQQSVTAAHLQHNGQQ-- 64

  Fly    71 QAVAAAAAAVTQQLQQQQQAVVAQQAVVQQQQQQAAAVVQQAAVQQAVVPQPQQAQPNTNGNAGS 135
                       |..|||||    ||...||||||          ||.|                 
  Fly    65 -----------QHSQQQQQ----QQMSQQQQQQQ----------QQLV----------------- 87

  Fly   136 GSQNGSNGSTETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKG 200
                |:|...| :.::.|..|...:...:::..|:..|||...:::||             |...
  Fly    88 ----GNNSKPE-QFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRD-------------PQTL 134

  Fly   201 QSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIK------------------- 246
            :|.|||||::|:..:||.|:..:||..|.:::|:.::|.....|.|                   
  Fly   135 KSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSP 199

  Fly   247 --------GANLYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEA 303
                    |.|..:||.   :.::.|:..|:|:|.|...|:.::       ||..|:||..:|.|
  Fly   200 TNCTVYCGGINGALSGF---LNEEILQKTFSPYGTIQEIRVFKD-------KGYAFVRFSTKEAA 254

  Fly   304 TRAIIALNGTTPSSCTDPIVVKFSNTPGSTSKIIQPQLPAFLNPQLVRRIGGAMHTPVNKGLARF 368
            |.||:|:|.|.                              :|.|.|:...|......|    ..
  Fly   255 THAIVAVNNTE------------------------------INQQPVKCAWGKESGDPN----HM 285

  Fly   369 SPMAGDMLDVMLPNGLGAAAAAATTLASGPGGAYPIFIYNLAPETEEAALWQLFGPFGAVQSVKI 433
            |.:||..|....|.|..||||||........|    :.|..||....||      |..|:|..:.
  Fly   286 SAIAGGALAQGFPFGSAAAAAAAAAYGQQVAG----YWYPPAPTYPAAA------PASALQPGQF 340

  Fly   434 VKDP---TTNQCKGY---GFVSM 450
            ::..   |..|..||   |::.|
  Fly   341 LQGMQGFTYGQFAGYQQAGYMGM 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 82/338 (24%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 23/86 (27%)
RRM3_TIA1_like 202..278 CDD:240800 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.