DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and CG1316

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:398 Identity:90/398 - (22%)
Similarity:160/398 - (40%) Gaps:113/398 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QAQPNTNGNAGSGSQNGSNGSTETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVY 188
            ::|..:.|  |.|.|..||......:.|.: ...:..||::.|..||..||||.:.:::||    
  Fly     5 RSQSRSGG--GRGGQEYSNDDDPPMSRLFI-ICNKAHTEEDFREAFSPYGEIEDIWVVKDK---- 62

  Fly   189 IDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRL--QNKTIKVSFA--------RPSSD 243
                     ...::.|..:|.:.:..||.:|...:||..:  .::|:||..|        :..::
  Fly    63 ---------HTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENE 118

  Fly   244 AIKGANLYVSGLPKTMTQQELEAIFAPFGAIITSRIL--QNAGNDTQTKGVGFIRFDKREEATRA 306
            ..|...|::. :|||.|::::...|:.:|.:.:..|:  :|.||   .||.|::||.|...|..|
  Fly   119 QEKYVRLFIV-IPKTATEEDIREEFSQWGDVESVTIVKEKNNGN---PKGFGYVRFTKFYYAAVA 179

  Fly   307 IIALNGTTPSSCTDPIVVKFSNTPGST-SKIIQPQLPAFLNPQLVRRIGGAMHTPVNKGLARFSP 370
            .        .:|:......|:...||| ::..|...|:..||         :::...:|.:.|  
  Fly   180 F--------ENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDNP---------LYSSSGRGNSNF-- 225

  Fly   371 MAGDMLDVMLPNGLGAAAAAATTLASGPGG---------------------------AYPIFI-Y 407
                       ||.|:        :||.||                           |.|..: .
  Fly   226 -----------NGGGS--------SSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQPSCLEV 271

  Fly   408 NLAPETEEAALWQLFGPFGAVQSVKIVKD--PTTNQCKGYGFVSMTNYDEAAMAIRA---LNG-- 465
            |::....:..||:||.....:...:|:::  |.||:       ::..||....||.|   |:|  
  Fly   272 NVSNCVNQDQLWRLFDIIPGLDYCQIMREHGPRTNE-------ALVVYDNPEAAIYAKDKLHGLE 329

  Fly   466 YTMGNRVL 473
            |.||.|::
  Fly   330 YPMGERII 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 83/376 (22%)
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 22/93 (24%)
RRM2_RBM45 122..195 CDD:240813 21/84 (25%)
RRM3_RBM45 267..339 CDD:240814 20/78 (26%)
RRM4_RBM45 383..449 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.