DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and CG4612

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:108/265 - (40%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QQQQTQQAVAAAAAAVTQQLQQQQQAVVAQQAV----VQQQQQQAAAVVQQAAVQQAVVPQPQQA 125
            |||........|||...|||.....|......|    .......||||:.:.............:
  Fly    17 QQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHGHNSLGSGHTSTS 81

  Fly   126 QPNTN-------GNAGSGSQNGSNGSTETRTNLI-VNYLPQTMTEDEIRSLFSSVGEIESVKLIR 182
            ..:.|       |...|||..||.|::...:..| :..|.:::....:...||..|.|.:..:.:
  Fly    82 SHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAK 146

  Fly   183 DKSQVYIDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARPSSD---- 243
            |:.              |.|.|||||::...:.|..|:..:||:...|:.:.|....|..|    
  Fly   147 DED--------------GNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQE 197

  Fly   244 -AIKGANLYVSGLPKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAI 307
             |....||||..|.:..|:|.|..:|.|:|.|.:.:::.:  .:.:::..||:.::..:.|..|:
  Fly   198 KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLD--EEGRSRRFGFVAYENPQSALAAV 260

  Fly   308 IALNG 312
            |.|:|
  Fly   261 IGLHG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 42/173 (24%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/83 (23%)
RRM3_I_PABPs 202..282 CDD:240826 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.