DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and Sxl

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster


Alignment Length:219 Identity:84/219 - (38%)
Similarity:128/219 - (58%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PQQAQPNTNGNAGSGSQNGSNGSTE-------TRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVK 179
            |..|..|:..|. .|...||.||.:       :.||||||||||.||:.|:.:||.::|.|.:.:
  Fly    84 PPMASNNSLNNL-CGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCR 147

  Fly   180 LIRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDA 244
            ::||.             ..|.|.||.||::....|:::|:.||||:.::||.:|||:|||..::
  Fly   148 IMRDY-------------KTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGES 199

  Fly   245 IKGANLYVSGLPKTMTQQELEAIFAPFGAIITSRILQN--AGNDTQTKGVGFIRFDKREEATRAI 307
            ||..||||:.||:|:|..:|:.||..:|:|:...||::  .|   :.:||.|:|::|||||..||
  Fly   200 IKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTG---RPRGVAFVRYNKREEAQEAI 261

  Fly   308 IALNGTTPSSCTDPIVVKFSNTPG 331
            .|||...|...:.|:.|:.:...|
  Fly   262 SALNNVIPEGGSQPLSVRLAEEHG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 75/195 (38%)
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 39/92 (42%)
RRM2_Hu_like 203..281 CDD:240822 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.