DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and Elavl1

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001102318.1 Gene:Elavl1 / 363854 RGDID:1308649 Length:326 Species:Rattus norvegicus


Alignment Length:341 Identity:180/341 - (52%)
Similarity:234/341 - (68%) Gaps:41/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVR 212
            |||||||||||.||::|:||||||:||:||.||||||             ..|.||||||||||.
  Rat    19 RTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDK-------------VAGHSLGYGFVNYVT 70

  Fly   213 PQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVSGLPKTMTQQELEAIFAPFGAIITS 277
            .:|||:|::.|||||||:||||||:|||||:.||.||||:||||:||||:::|.:|:.||.||.|
  Rat    71 AKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINS 135

  Fly   278 RIL--QNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFSNTPGSTSKI-IQP 339
            |:|  |..|   .::||.|||||||.||..||.:.||..|...::||.|||:..|.....: :..
  Rat   136 RVLVDQTTG---LSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMALLS 197

  Fly   340 QLPAFLNPQLVRRIGGAMHTPVNKGLARFSPMAGDMLDVMLPNGLGAAAAAATTLASGPGGA--- 401
            ||  :.:|  .||.||.:|....:  .|||||..|.:     :|:..        .:.||.|   
  Rat   198 QL--YHSP--ARRFGGPVHHQAQR--FRFSPMGVDHM-----SGISG--------VNVPGNASSG 243

  Fly   402 YPIFIYNLAPETEEAALWQLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGY 466
            :.||||||..:.:|..|||:|||||||.:||:::|..||:|||:|||:||||:||||||.:||||
  Rat   244 WCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGY 308

  Fly   467 TMGNRVLQVSFKTNKA 482
            .:|:::|||||||||:
  Rat   309 RLGDKILQVSFKTNKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 180/341 (53%)
Elavl1NP_001102318.1 ELAV_HUD_SF 19..326 CDD:273741 180/341 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.