DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and crp79

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001018242.1 Gene:crp79 / 3361521 PomBaseID:SPAC1610.03c Length:710 Species:Schizosaccharomyces pombe


Alignment Length:486 Identity:96/486 - (19%)
Similarity:164/486 - (33%) Gaps:177/486 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GSTETRTNLI-VNYLPQTMTEDEIRSLFSSVGEIESV--KLI-----RDKSQVYIDPLNPQAPSK 199
            |..|..::.| |..:...::::||...||..|::||:  :|:     ::|::.:..|.|      
pombe    10 GQYEDESSTIYVGNIDSRLSDEEIIKHFSKYGQVESIFRRLLDSFYPKEKAKPFKPPKN------ 68

  Fly   200 GQSLGYGFVNYVRPQDAEQAVNVLNGLRL-QNK-TIKVSFARPSSDAIKGANLYVSGLPKTMTQQ 262
              .:.||||.:|..:..|:.:....|:.| |.| |||.....|:.                :|.:
pombe    69 --GVQYGFVKFVNAESIEEVLKDAKGMTLGQRKLTIKARVVNPAK----------------LTDK 115

  Fly   263 ELEAIFAPFGAIITSRILQ-NAGNDTQTKGV--GFIRFDKRE----------EATRAIIALNG-- 312
            :    |.|....||:.:.. :..|:|..:.|  |..:...:|          |..|.|.:.|.  
pombe   116 K----FKPNDTSITANVFNPSIQNNTDEENVKPGLKQSQIKEFIPNVEERNWETVRGINSRNPKP 176

  Fly   313 ----TTPSSCTDPIVVK-FSNTPGSTSKIIQPQLPAFLNP----QLVRRIGGAMHTPVNKGL--- 365
                |.||...:.|.:: ..|...||..:....|||.:.|    ...::.|....|.|::.|   
pombe   177 ETTLTIPSLGLEDISMQVVPNAFASTLPLSILNLPAEVTPIDLYNHFKQAGVVKGTAVSQFLDQR 241

  Fly   366 -ARFS--------------------PMAGDMLDVMLPNGLGAAAAAATTLASGPGG----AYP-- 403
             .|:.                    |..|.:|:|.:.|   .|:::..::.:.|.|    .:|  
pombe   242 GFRYGEVIMDSVESCQNAIEKLNNVPYKGSILEVSIKN---KASSSVKSIPTTPTGESLWPFPSE 303

  Fly   404 ------IFIYN---------LAPETEEAALW---------------------------------- 419
                  |.|.|         :...|:|.:.|                                  
pombe   304 NANKTQINIENATCSKMTWIMGSPTKEKSQWGSVSTTGVSNQQNHPAAWNPDNKPQSIVHWDSLR 368

  Fly   420 ---------------------------------QLFGPFGAVQSVKIVKDPTTNQCKGYGFVSMT 451
                                             .||.|||::.|..:...|.:...||||||:..
pombe   369 ESSPSIPNSPIDPSNLYVKNLDDTVITCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAFR 433

  Fly   452 NYDEAAMAIRALNGYTMGNRVLQVSFKTNKA 482
            ..:.|..|...|||..:|.:.:.|.|...|:
pombe   434 QIEAAVRAKDTLNGMMVGKKRIFVCFAERKS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 95/483 (20%)
crp79NP_001018242.1 RRM_RBM18 18..106 CDD:240801 26/95 (27%)
RRM 109..>289 CDD:223796 37/202 (18%)
RRM_SF 205..276 CDD:240668 12/70 (17%)
RRM2_I_PABPs 380..459 CDD:240825 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.