DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and copb-1

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_494441.1 Gene:copb-1 / 173656 WormBaseID:WBGene00021292 Length:971 Species:Caenorhabditis elegans


Alignment Length:251 Identity:48/251 - (19%)
Similarity:82/251 - (32%) Gaps:86/251 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GVDTQ--------AQLMQSAAAAAAVAATNAAAAPVQNAAAVAAAAQLQQQQVQ--------QAI 61
            |:|.|        .:||..|.:.:.:..|      .:..|:..||....:..|:        |..
 Worm   629 GLDEQYGDDCKKSLELMLGAKSISRLDVT------TEKMASTTAAGYRSKDFVEIDKTINFTQLS 687

  Fly    62 LQVQQQ-------QTQQAVAAAAAAVTQQLQQQQQAVVAQ----------QAVVQQQQ------- 102
            .:..||       ...||:..|..|........:...|.|          :|.|...|       
 Worm   688 ARSNQQGENLFDLSLSQALGTAPKAQKFDFSSSKLGKVIQLAGFSDPIYAEAYVNVNQYDIVLDV 752

  Fly   103 ---QQAAAVVQQAAVQQAVV--------PQPQQAQPNTNGNAG-----SGSQNG---------SN 142
               .|.:..:|..:::.|.|        |.|....||...|..     :.::||         ..
 Worm   753 LIVNQTSDTLQNVSLELATVGDLKLVDKPTPVTLAPNDFSNIKATVKVASTENGVIFSTISYDVT 817

  Fly   143 GSTETRTNL--------IVNYL-PQTMTEDEIRSLFS------SVGEIESVKLIRD 183
            |||..|..:        |::|: |..:|:.|.|:::|      .|..:..::.:||
 Worm   818 GSTSDRNCVYLQDIKIDIMDYIVPGNVTDTEFRTMWSDFEWENKVNVMTPIRDLRD 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 11/53 (21%)
copb-1NP_494441.1 COG5096 31..935 CDD:227427 48/251 (19%)
HEAT repeat 138..162 CDD:293787
HEAT repeat 174..222 CDD:293787
HEAT repeat 245..275 CDD:293787
HEAT repeat 284..308 CDD:293787
HEAT repeat 319..343 CDD:293787
Coatamer_beta_C 677..816 CDD:285019 23/138 (17%)
Coatomer_b_Cpla 825..953 CDD:291472 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S39
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.