DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elav and Elavl3

DIOPT Version :9

Sequence 1:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_034617.1 Gene:Elavl3 / 15571 MGIID:109157 Length:367 Species:Mus musculus


Alignment Length:376 Identity:196/376 - (52%)
Similarity:248/376 - (65%) Gaps:53/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GNAGSGSQN----GSNGST-ETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYID 190
            |.||....|    |:||:| :::||||||||||.||:||.:|||.|:|:|||.||:|||      
Mouse    16 GPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDK------ 74

  Fly   191 PLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVSGL 255
                   ..|||||||||||..|.||::|:|.||||:||.||||||:|||||.:|:.||||||||
Mouse    75 -------ITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGL 132

  Fly   256 PKTMTQQELEAIFAPFGAIITSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTD 320
            ||||:|:|:|.:|:.:|.|||||||.:..... ::||||||||||.||..||..|||..|....:
Mouse   133 PKTMSQKEMEQLFSQYGRIITSRILLDQATGV-SRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAE 196

  Fly   321 PIVVKFSNTPGSTSKIIQPQLPAFLNPQLVRRIGGAMH-------------------TPVNKGLA 366
            ||.|||:|.|   |:.....|...|.....||..|.:|                   :|::. :|
Mouse   197 PITVKFANNP---SQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSL-IA 257

  Fly   367 RFSPMAGDMLDVMLPNGLGAAAAAATTLASGPGGA-YPIFIYNLAPETEEAALWQLFGPFGAVQS 430
            ||||:|.|          |.:..|...|:.|..|| :.||:|||:||.:|:.|||||||||||.:
Mouse   258 RFSPIAID----------GMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVLWQLFGPFGAVTN 312

  Fly   431 VKIVKDPTTNQCKGYGFVSMTNYDEAAMAIRALNGYTMGNRVLQVSFKTNK 481
            ||:::|.|||:|||:|||:|||||||||||.:||||.:|.|||||||||:|
Mouse   313 VKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 188/356 (53%)
Elavl3NP_034617.1 ELAV_HUD_SF 36..366 CDD:273741 188/356 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.