DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment elav and COPB1

DIOPT Version :9

Sequence 1:	NP_001245447.1	Gene:	elav / 31000	FlyBaseID:	FBgn0260400	Length:	483	Species:	Drosophila melanogaster
Sequence 2:	NP_001137533.1	Gene:	COPB1 / 1315	HGNCID:	2231	Length:	953	Species:	Homo sapiens

Alignment Length:	129	Identity:	23/129 - (17%)
Similarity:	50/129 - (38%)	Gaps:	26/129 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   150 NLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNY---V 211
            :::::.|....|.|.:::....:..:..:||:...|.:.:.|             :.|.|.   |
Human   738 DIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAP-------------HDFANIKANV 789

  Fly   212 RPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVSGL----PKTMTQQELEAIFAPF 271
            :....|      ||:...|....||.|....:.:..:::::..:    |.|.|..|...::|.|
Human   790 KVASTE------NGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMWAEF 847

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
elav	NP_001245447.1	ELAV_HUD_SF	146..483	CDD:273741	23/129 (18%)
COPB1	NP_001137533.1	Adaptin_N	18..550	CDD:279882
		HEAT 1	96..131
		HEAT 2	132..168
		HEAT repeat	137..161	CDD:293787
		HEAT repeat	173..211	CDD:293787
		HEAT repeat	221..272	CDD:293787
		HEAT 3	240..276
		HEAT 4	277..314
		HEAT repeat	280..307	CDD:293787
		HEAT 5	316..353
		HEAT repeat	318..342	CDD:293787
		HEAT 6	396..433
		Coatamer_beta_C	667..807	CDD:285019	14/87 (16%)
		Coatomer_b_Cpla	816..944	CDD:291472	6/32 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S39
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950